PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_5.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 442aa    MW: 47495.1 Da    PI: 8.2056
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_5.28genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.21.2e-15357407555
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                 +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN+ Lk +l el+  
  evm.model.supercontig_5.28 357 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTHLKHTLAELETR 407
                                 79********************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-14353417IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323355405IPR004827Basic-leucine zipper domain
CDDcd147072.02E-24357411No hitNo description
PfamPF001702.3E-13357409IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-15357409No hitNo description
SuperFamilySSF579592.31E-11357406No hitNo description
PROSITE patternPS000360360375IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MAVHGDLRES PPHGDPYQKN GSLPFSCLGR QSSIYSLTLD EFQHALCESG KNFGSMNMEE  60
FLTSIWNAEE NQAVCTGTNT TISIPSNLNN DENQLASLDV PLGADAGAGR SGGAGKQPSL  120
ARQGSLTIPA PLCRKTVEEV WSEIHKGQRG EGGGRDGNES GGSNLQTLSS ASQQPTFGEM  180
TLEDFLIKAG VVREQCAVVP PSLAPQQQHF GVYQNTNNAN VAPSYVPRHI MTMGGNNNSG  240
GGPSGSSGVY PPMHTAGGGV IGEPTGYANN GKMNGGYPQA PSRPTSAVCY GGRVANGGGY  300
APVQPIAVVP PMSPVAPSDM CTSQVDCAGN QYGMDMSVVL RGRKRIIDGP VEKVVERRQR  360
RMIKNRESAA RSRARKQAYT VELEAELNQL KEENTHLKHT LAELETRRKQ QYFEEIKTNA  420
QTKAERAREK LRLLRRTVSW P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290298GGRVANGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027722.11e-156Basic-leucine zipper transcription factor family protein, putative isoform 1
RefseqXP_007027723.11e-156Basic-leucine zipper transcription factor family protein, putative isoform 1
SwissprotQ9SJN01e-111ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A061F1561e-156A0A061F156_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 1
STRINGSolyc09g009490.2.11e-122(Solanum lycopersicum)
STRINGGLYMA10G08370.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-102bZIP family protein